SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free, E. coli

Artikelnummer: TRZ-P2020-019_500
Artikelname: SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free, E. coli
Artikelnummer: TRZ-P2020-019_500
Hersteller Artikelnummer: P2020-019_500
Alternativnummer: TRZ-P2020-019_500
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, WB
Spezies Reaktivität: Virus
Alternative Synonym: 3CL Mpro, 3CL Pro, 3CL protease, 3C-like main protease, SARS-CoV-2, coronavirus, 2019-nCoV, COVID-2019, COVID-21, covid-19, sars-cov-2
The new coronavirus SARS-CoV-2 expresses two proteases, the papain-like protease (PLpro) and 3C-like protease (3CLpro). Both belong to the group of cysteine proteases, as they have a cysteine residue at their catalytic site. Their main function is the processing of the viral polyprotein, that contains two cleavage sites to build up the viral replicase complex. Additionally, PLpro has the ability of removing ISG15 and ubiquitin from viral proteins expressed in the cell, this enables evasion from the innate immune response by the host. This represents an interesting target for drug development. This is because it not only would inhibit viral replication, but would also prevent the massive immunological response that results from the over-activation of the host’s immune system. Such an over-activation can lead to damage of the uninfected cells and thus to a worsening of the patient’s condition. N-terminal His-Tag was removed to restore protease activity.
Molekulargewicht: 36,0 kDa
UniProt: P0DTD3
Puffer: PBS, contains Glycerol as protectant
Reinheit: > 90% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDIL
Formel: pH 7,4
SDS-Page of SARS-CoV-2 (COVID-19) 3CL-Mpro Protein Tag-free
Structural model of 3CL-Mpro Protein Tag-free