SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, unmodified, E. coli

Artikelnummer: TRZ-P2020-027_500
Artikelname: SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, unmodified, E. coli
Artikelnummer: TRZ-P2020-027_500
Hersteller Artikelnummer: P2020-027_500
Alternativnummer: TRZ-P2020-027_500
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Virus
Alternative Synonym: 3CL Mpro, 3CL Pro, 3CL protease, 3C-like main protease, SARS-CoV-2, coronavirus, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The new coronavirus SARS-CoV-2 expresses two proteases, the papain-like protease (PLpro) and 3C-like protease (3CLpro). Both belong to the group of cysteine proteases, as they have a cysteine residue at their catalytic site. Their main function is the processing of the viral polyprotein, that contains two cleavage sites to build up the viral replicase complex. Additionally, PLpro has the ability of removing ISG15 and ubiquitin from viral proteins expressed in the cell, this enables evasion from the innate immune response by the host. This presents an interesting target for drug development, as it would not only inhibit the viral replication but would also prevent the massive immunological response resulting of the over-activation of the host´s immune system, that can lead to damaging of uninfected cells and therefore worsening of the patient´s condition. Our protein contains no additional amino acids at the N-terminus like proteins from competitors. Therefore, the protease has the authentic N-terminus which is part of the active site of the protein. N-terminal His-Tag was removed by a proteolytic digest producing an authentic N-terminus to ensure highest proteolytic activity.
Molekulargewicht: 33,8 kDa
UniProt: P0DTD1
Puffer: 20 mM Tris, 150 mM NaCl, 1 mM DTT, 20% (v/v) Glyverol
Reinheit: > 90% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDIL
Formel: pH 7.5
SDS-Page of 3CL-Mpro Protein unmodified
Structural model of 3CL-Mpro Protein unmodified