SARS-CoV-2 (COVID-19) S Protein, Tag-removed, stabilized trimer

Artikelnummer: TRZ-P2020-029_100
Artikelname: SARS-CoV-2 (COVID-19) S Protein, Tag-removed, stabilized trimer
Artikelnummer: TRZ-P2020-029_100
Hersteller Artikelnummer: P2020-029_100
Alternativnummer: TRZ-P2020-029_100
Hersteller: trenzyme
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Virus
Alternative Synonym: SARS-CoV-2, coronavirus, SARS-CoV-2 spike protein, S glycoprotein, spike glycoprotein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the recognition of the receptor on the surface of a susceptible cell. In addition, the S2 subunit is responsible for the fusion of the virus with the cell membrane of the host cell. Upon binding of the host receptor hACE2, the distal S1 domain is cleaved. This reveals the fusion machinery of the S2 subunit, which mediates the entry into the cell. Moreover, the Spike protein is heavily glycosylated by N-linked glycans that are important for the proper folding of the protein and the recognition by neutralizing antibodies. The engineered recombinant Spike protein contains specific amino acid substitutions to stabilize the prefusion conformation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted and an artificial trimerization domain was added to the C-terminal end of the monomer. Above all, the spike is a major immunogen and an interesting target for vaccine development as well as for serological assays.
Molekulargewicht: 136,4 kDa
UniProt: P0DTC2
Puffer: PBS, 5% (w/v) Trehalose
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF KNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDS SSGWTAGAAA
Formel: pH 7,4
Structural model of S Protein Tag-removed Stabilized Trimer