Alpha-1-antitrypsin, Human

Artikelnummer: TRZ-P2020-112_100
Artikelname: Alpha-1-antitrypsin, Human
Artikelnummer: TRZ-P2020-112_100
Hersteller Artikelnummer: P2020-112_100
Alternativnummer: TRZ-P2020-112_100
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: Alpha-1 protease inhibitor, Alpha-1-antiproteinase, Serpin A1, A1AT Protein, Alfa1 antitrypsin, Alpha 1-antitrypsin, Alpha 1-Proteinase Inhibitor, Alpha 1-proteinase inhibitor (human), Alpha 1-proteinase inhibitor, human, Alpha-1 protease inhibitor, Alph
Alpha-1-antitrypsin also known as Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) preventing the proteolysis of elastin tissues in alveolar lung structures. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Molekulargewicht: 45,8 kDa
UniProt: P01009
Puffer: 10 mM Tris, 200 mM NaCl, 1 mM EDTA, 1 mM ß-Mercaptoethanol
Reinheit: > 95% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFL
Formel: pH 8,0
Structural model of Alpha 1 antitrypsin
SDS-Page of Alpha 1 antitrypsin