Catalase, E. coli

Artikelnummer: TRZ-P2020-127_100
Artikelname: Catalase, E. coli
Artikelnummer: TRZ-P2020-127_100
Hersteller Artikelnummer: P2020-127_100
Alternativnummer: TRZ-P2020-127_100
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: H. pylori
Alternative Synonym: KatA
Catalases are conserved and abundant enzyme found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor. KatA is used as biomarker for duodenal ulcer (DU) and also for gastritic cancer (GC).
Molekulargewicht: 86,9 kDa
UniProt: P77872
Puffer: PBS
Reinheit: > 75% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPDSNQRDLFNAIARGD
Formel: pH 7,4
SDS-Page of Catalase
Structural model of Catalase