human Interleukin-1 beta, tag-free, E. coli

Artikelnummer: TRZ-P2020-136_20
Artikelname: human Interleukin-1 beta, tag-free, E. coli
Artikelnummer: TRZ-P2020-136_20
Hersteller Artikelnummer: p2020-136_20
Alternativnummer: TRZ-P2020-136_20
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: IL-1 beta, Catabolin, IL-1B, IL-1 beta Protein, IL1-BETA Protein, IL1F2 Protein
The pro-inflammatory cytokine Interleukin-1 beta (IL-1 beta) is produced by a variety of cell types, including macrophages, dendritic cells, fibroblasts, endothelial cells and keratinocytes. Activation of IL-1 beta is tightly regulated as it is first produced as inactive precursor in response to infection or cell injury and has to be proteolytically cleaved by caspase-1, which is activated by a cytosolic pro-inflammatory signaling complex, the inflammasome. Proteolytic cleavage of pro-IL-1 beta results in secretion of mature IL-1 beta and induction of inflammatory responses by binding to the IL-1 type I receptor (IL-1RI). In particular, activation of IL-1 beta induces inflammation, fever, synthesis of acute phase proteins, as well as proliferation and differentiation of lymphocytes emphasizing its versatile biological functions. Activity is further regulated by several endogenous inhibitors including IL-1 type II receptor (IL-1RII) and IL-1 receptor antagonist (IL-1Ra). Dysregulation causes pathological conditions ranging from chronic inflammatory and autoinflammatory diseases to autoimmune syndromes, neurodegenerative diseases and cancer.
Molekulargewicht: 17,6 kDa
UniProt: P01584
Puffer: PBS
Reinheit: > 95% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Formel: pH 7,4