human Interleukin-10, tag-free, Human

Artikelnummer: TRZ-P2020-146_10
Artikelname: human Interleukin-10, tag-free, Human
Artikelnummer: TRZ-P2020-146_10
Hersteller Artikelnummer: p2020-146_10
Alternativnummer: TRZ-P2020-146_10
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: Interleukin 10, IL-10, IL10, Cytokine synthesis inhibitory factor (CSIF), CSIF Protein, TGIF Protein, GVHDS
Interleukin-10 (IL-10) is a cytokine that plays a crucial role in the regulation of both innate and adaptive immune responses and controls inflammatory processes. It was first identified in the early 1990s and has since been extensively studied for its immunoregulatory functions. IL-10 is produced by various immune cells, including effector T cells, B cells, classically and especially alternatively activated macrophages, dendritic cells (DCs), as well as certain non-immune cells. IL-10 is often referred to as an "anti-inflammatory cytokine" because of its ability to suppress inflammation. It inhibits the production of pro-inflammatory cytokines like interleukin-1 (IL-1), interleukin-6 (IL-6), interleukin-12 (IL-12) and tumor necrosis factor-alpha (TNF-α). Moreover, IL-10 suppresses expression of MHC class II and costimulatory molecules B7-1/B7-2 on monocytes and macrophages, thereby impeding T cell activation and differentiation in the lymph nodes. IL-10 is both produced by macrophages and DCs and inhibits their function by suppressing production of inflammatory cytokines indicating a sophisticated negative feedback mechanism that limits potential damage to tissues. The non-covalently associated homodimer IL-10 binds to the type II cytokine receptor IL-10 consisting of two IL-10 R alpha chains. Binding results in the recruitment of two IL-10 R beta chains, which are essential for signal transduction. Signaling induces activation of Janus Kinase 1 (JAK1), Tyrosine Kinase 2 (TYK2), and the transcription factor STAT3. Dysregulation of IL-10 is implicated in various diseases. For example, deficient IL-10 production or function is associated with inflammatory bowel diseases (IBD) like Crohn's disease and ulcerative colitis. Conversely, excessive IL-10 production can contribute to immune evasion by certain pathogens and promote the survival of cancer cells by suppressing anti-tumor immune responses. Noteworthy, while human IL-10 is able to activate also murine cells, murine IL-10 is inactive on human cells.
Molekulargewicht: 18,8 kDa
UniProt: P22301
Puffer: PBS
Reinheit: > 90% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Formel: pH 7,4