ZBTB7A (Zinc Finger and BTB Domain-Containing Protein 7A, FBI 1, FBI1, FBI-1, Pokemon, TIP21, ZBT7A, ZBTB7, Zinc Finger Protein 857A, ZNF857A), Rabbit

Artikelnummer: USB-353130
Artikelname: ZBTB7A (Zinc Finger and BTB Domain-Containing Protein 7A, FBI 1, FBI1, FBI-1, Pokemon, TIP21, ZBT7A, ZBTB7, Zinc Finger Protein 857A, ZNF857A), Rabbit
Artikelnummer: USB-353130
Hersteller Artikelnummer: 353130
Alternativnummer: USB-353130-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: Synthetic peptide corresponding to aa125-163 DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF of human ZBTB7A at N-terminal.
Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the ZBTB7A gene. ZBTB7A has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: O95365
Reinheit: Purified by immunoaffinity chromatography.
Formulierung: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.