NUP153, Recombinant, Human, aa657-880, His-Tag (Nuclear Pore Complex Protein Nup153)

Produktübersicht

• Artikelname: NUP153, Recombinant, Human, aa657-880, His-Tag (Nuclear Pore Complex Protein Nup153)
• Artikelnummer: USB-374515
• Hersteller Artikelnummer: 374515
• Alternativnummer: USB-374515-20,USB-374515-100,USB-374515-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding element in the nuclear phase of the NPC essential for normal nucleocytoplasmic domain transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus, in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport element (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear membrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore membrane. Possible DNA-binding subunit of the nuclear pore complex (NPC). Recombinant protein corresponding to aa657-880 from NUP153, fused to 6X His-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: P49790 Molecular Weight: ~27.3kD Amino Acid Sequence: KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 27.3
• UniProt: P49790
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.