NUTF2, Recombinant, Human, aa1-127, GST-Tag (Nuclear Transport Factor 2)

Produktübersicht

• Artikelname: NUTF2, Recombinant, Human, aa1-127, GST-Tag (Nuclear Transport Factor 2)
• Artikelnummer: USB-374519
• Hersteller Artikelnummer: 374519
• Alternativnummer: USB-374519-20,USB-374519-100,USB-374519-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import. Source: Recombinant protein corresponding to aa1-127 from human NUTF2, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~41.5kD Amino Acid Sequence: MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.5
• UniProt: P61970
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.