OBP2A, Recombinant, Human, aa16-170, His-SUMO-Tag (Odorant-binding Protein 2a)

Produktübersicht

• Artikelname: OBP2A, Recombinant, Human, aa16-170, His-SUMO-Tag (Odorant-binding Protein 2a)
• Artikelnummer: USB-374524
• Hersteller Artikelnummer: 374524
• Alternativnummer: USB-374524-20,USB-374524-100,USB-374524-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. Source: Recombinant protein corresponding to aa16-170 from human OBP2A, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~33.8kD Amino Acid Sequence: LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.8
• UniProt: Q9NY56
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.