OTC, Recombinant, Mouse, aa33-354, His-SUMO-Tag (Ornithine Carbamoyltransferase, Mitochondrial)

Produktübersicht

• Artikelname: OTC, Recombinant, Mouse, aa33-354, His-SUMO-Tag (Ornithine Carbamoyltransferase, Mitochondrial)
• Artikelnummer: USB-374569
• Hersteller Artikelnummer: 374569
• Alternativnummer: USB-374569-20,USB-374569-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa33-354 from mouse Otc, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.1kD Amino Acid Sequence: SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSF

Produkteigenschaften

• Molekulargewicht: 52.1
• UniProt: P11725
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.