PEA15, Recombinant, Human, aa1-130, GST-Tag (Astrocytic Phosphoprotein PEA-15)

Artikelnummer: USB-374658
Artikelname: PEA15, Recombinant, Human, aa1-130, GST-Tag (Astrocytic Phosphoprotein PEA-15)
Artikelnummer: USB-374658
Hersteller Artikelnummer: 374658
Alternativnummer: USB-374658-20,USB-374658-100,USB-374658-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface. Recombinant protein corresponding to aa1-130 from human PEA15, fused to GST-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: Q15121 Molecular Weight: ~42.0kD Amino Acid Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42
UniProt: Q15121
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.