Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag

Produktübersicht

• Artikelname: Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag
• Artikelnummer: USB-374661
• Hersteller Artikelnummer: 374661
• Alternativnummer: USB-374661-20,USB-374661-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Has pectate lyase activity. Source: Recombinant protein corresponding to aa22-375 from chamaecyparis obtusa, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~40.1kD Amino Acid Sequence: DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS

Produkteigenschaften

• Molekulargewicht: 40.1
• UniProt: Q96385
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.