PHGDH, Recombinant, Human, aa2-251, GST-Tag (D-3-phosphoglycerate Dehydrogenase)

Produktübersicht

• Artikelname: PHGDH, Recombinant, Human, aa2-251, GST-Tag (D-3-phosphoglycerate Dehydrogenase)
• Artikelnummer: USB-374686
• Hersteller Artikelnummer: 374686
• Alternativnummer: USB-374686-20,USB-374686-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa2-251 from human PHGDH, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.8kD Amino Acid Sequence: AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNV

Produkteigenschaften

• Molekulargewicht: 53.8
• UniProt: O43175
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.