PHPT1, Recombinant, Human, aa1-125, GST-Tag (14kD Phosphohistidine Phosphatase)

Produktübersicht

• Artikelname: PHPT1, Recombinant, Human, aa1-125, GST-Tag (14kD Phosphohistidine Phosphatase)
• Artikelnummer: USB-374697
• Hersteller Artikelnummer: 374697
• Alternativnummer: USB-374697-20,USB-374697-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Exhibits phosphohistidine phosphatase activity. Source: Recombinant protein corresponding to aa1-125 from human PHPT1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.8kD Amino Acid Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSG

Produkteigenschaften

• Molekulargewicht: 40.8
• UniProt: Q9NRX4
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.