PHPT1, Recombinant, Human, aa1-125, His-Tag (14kD Phosphohistidine Phosphatase)

Produktübersicht

• Artikelname: PHPT1, Recombinant, Human, aa1-125, His-Tag (14kD Phosphohistidine Phosphatase)
• Artikelnummer: USB-374698
• Hersteller Artikelnummer: 374698
• Alternativnummer: USB-374698-20,USB-374698-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Exhibits phosphohistidine phosphatase activity. Source: Recombinant protein corresponding to aa1-125 from human PHPT1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.8kD Amino Acid Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAP

Produkteigenschaften

• Molekulargewicht: 15.8
• UniProt: Q9NRX4
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.