PHYH, Recombinant, Human, aa1-338, GST-Tag (Phytanoyl-CoA Dioxygenase, Peroxisomal)

Produktübersicht

• Artikelname: PHYH, Recombinant, Human, aa1-338, GST-Tag (Phytanoyl-CoA Dioxygenase, Peroxisomal)
• Artikelnummer: USB-374701
• Hersteller Artikelnummer: 374701
• Alternativnummer: USB-374701-20,USB-374701-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Source: Recombinant protein corresponding to aa1-338 from human PHYH, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62.4kD Amino Acid Sequence: SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEE

Produkteigenschaften

• Molekulargewicht: 62.4
• UniProt: O14832
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.