PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase Isozymes R/L)

Produktübersicht

• Artikelname: PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase Isozymes R/L)
• Artikelnummer: USB-374717
• Hersteller Artikelnummer: 374717
• Alternativnummer: USB-374717-20,USB-374717-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-574 from human PKLR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~65.8kD Amino Acid Sequence: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPV

Produkteigenschaften

• Molekulargewicht: 65.8
• UniProt: P30613
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.