PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase PKLR)

Produktübersicht

• Artikelname: PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase PKLR)
• Artikelnummer: USB-374718
• Hersteller Artikelnummer: 374718
• Alternativnummer: USB-374718-20,USB-374718-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Plays a key role in glycolysis. Source: Recombinant protein corresponding to aa1-574 from human PKLR, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~63.83kD Amino Acid Sequence: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELG

Produkteigenschaften

• Molekulargewicht: 63.83
• UniProt: P30613
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.