This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. Source: Recombinant protein corresponding to aa150-218 from Oncorhynchus mykiss Myelin Proteolipid Protein, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.71kD Amino Acid Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
