PolA, Recombinant, Thermus Aquaticus, aa289-832, GST-Tag (DNA Polymerase I, Thermostable)

Produktübersicht

• Artikelname: PolA, Recombinant, Thermus Aquaticus, aa289-832, GST-Tag (DNA Polymerase I, Thermostable)
• Artikelnummer: USB-374783
• Hersteller Artikelnummer: 374783
• Alternativnummer: USB-374783-20,USB-374783-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Partial recombinant protein corresponding to aa289-832 from thermus aquaticus DNA Polymerase I, Thermostable, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~88.3kD Amino Acid Sequence: ESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLA

Produkteigenschaften

• Molekulargewicht: 88.3
• UniProt: P19821
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.