Polygalacturonase, Recombinant, Chamaecyparis obtusa, aa51-514, His-SUMO-Tag

Produktübersicht

• Artikelname: Polygalacturonase, Recombinant, Chamaecyparis obtusa, aa51-514, His-SUMO-Tag
• Artikelnummer: USB-374793
• Hersteller Artikelnummer: 374793
• Alternativnummer: USB-374793-20,USB-374793-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Recombinant protein corresponding to aa51-514 from chamaecyparis obtusa Polygalacturonase, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~66.5kD Amino Acid Sequence: SRHDAATVFNVEQYGAVGDGKHDSTEAFATTWNAACKKASAVLLVPANKKFFVNNLV

Produkteigenschaften

• Molekulargewicht: 66.5
• UniProt: Q7M1E7
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.