PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)

Artikelnummer: USB-374808
Artikelname: PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)
Artikelnummer: USB-374808
Hersteller Artikelnummer: 374808
Alternativnummer: USB-374808-20,USB-374808-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May have a role in cell growth. Source: Recombinant protein corresponding to aa1-473 from human PPAN, fused to His-Tag at N-terminal expressed in Yeast. Molecular Weight: ~55.2kD Amino Acid Sequence: MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVM
Molekulargewicht: 55.2
UniProt: Q9NQ55
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.