PPBP, Recombinant, Human, aa59-125, GST-Tag (Platelet Basic Protein)

Artikelnummer: USB-374810
Artikelname: PPBP, Recombinant, Human, aa59-125, GST-Tag (Platelet Basic Protein)
Artikelnummer: USB-374810
Hersteller Artikelnummer: 374810
Alternativnummer: USB-374810-20,USB-374810-100,USB-374810-1
Hersteller: US Biological
Kategorie: Molekularbiologie
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. Source: Partial recombinant protein corresponding to aa59-125 from human PPBP, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.4kD Amino Acid Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.4
UniProt: P02775
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.