PTPN5, Recombinant, Human, aa300-555, His-SUMO-Tag (Tyrosine-protein Phosphatase Non-receptor Type 5)

Produktübersicht

• Artikelname: PTPN5, Recombinant, Human, aa300-555, His-SUMO-Tag (Tyrosine-protein Phosphatase Non-receptor Type 5)
• Artikelnummer: USB-374930
• Hersteller Artikelnummer: 374930
• Alternativnummer: USB-374930-20,USB-374930-100,USB-374930-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors. Source: Recombinant protein corresponding to aa300-555 from human PTPN5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.5kD Amino Acid Sequence: LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 45.5
• UniProt: P54829
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.