RMND5A, Recombinant, Human, His-SUMO-Tag (Protein RMD5 Homolog A)

Produktübersicht

• Artikelname: RMND5A, Recombinant, Human, His-SUMO-Tag (Protein RMD5 Homolog A)
• Artikelnummer: USB-375070
• Hersteller Artikelnummer: 375070
• Alternativnummer: USB-375070-20,USB-375070-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-385 from human RMND5A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.3kD Amino Acid Sequence: MDQCVTVERELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLA

Produkteigenschaften

• Molekulargewicht: 59.3
• UniProt: Q9H871
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.