S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)

Artikelnummer: USB-375183
Artikelname: S100A7A, Recombinant, Human, aa2-101, His-Tag (Protein S100-A7A)
Artikelnummer: USB-375183
Hersteller Artikelnummer: 375183
Alternativnummer: USB-375183-20,USB-375183-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. Source: Recombinant protein corresponding to aa2-101 from human S100A7A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD Amino Acid Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.2
UniProt: Q86SG5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.