SCML4, Recombinant, Human, aa1-305, His-SUMO-Tag (Sex Comb on Midleg-like Protein 4)

Produktübersicht

• Artikelname: SCML4, Recombinant, Human, aa1-305, His-SUMO-Tag (Sex Comb on Midleg-like Protein 4)
• Artikelnummer: USB-375221
• Hersteller Artikelnummer: 375221
• Alternativnummer: USB-375221-20,USB-375221-100,USB-375221-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. Source: Recombinant protein corresponding to aa1-305 from human SCML4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49kD Amino Acid Sequence: MPCQRTAWIGCDRQRTPPFHWREIKSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERKKVQQLPEHFGPERPSAVLQQAVQACIDCAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVTTEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATAGGPRTSPMSSGGPSAPGLRPPASSPKRNTTSLEGNRCGNVMHASASH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 49
• UniProt: Q8N228
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.