SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)

Artikelnummer: USB-375250
Artikelname: SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)
Artikelnummer: USB-375250
Hersteller Artikelnummer: 375250
Alternativnummer: USB-375250-20,USB-375250-100,USB-375250-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. Recombinant protein corresponding to aa20-381 from human SEPP1, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P49908 Molecular Weight: ~44.6kD Amino Acid Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 44.6
UniProt: P49908
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol