SLC25A15, Recombinant, Human, aa1-301, GST-Tag (Mitochondrial Ornithine Transporter 1)

Produktübersicht

• Artikelname: SLC25A15, Recombinant, Human, aa1-301, GST-Tag (Mitochondrial Ornithine Transporter 1)
• Artikelnummer: USB-375315
• Hersteller Artikelnummer: 375315
• Alternativnummer: USB-375315-20,USB-375315-100,USB-375315-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix. Source: Recombinant protein corresponding to aa1-301 from human SLC25A15, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~59.7kD AA Sequence: MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 59.7
• UniProt: Q9Y619
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.