SLC25A30, Recombinant, Human, aa1-291, His-SUMO-Tag (Kidney Mitochondrial Carrier Protein 1)

Produktübersicht

• Artikelname: SLC25A30, Recombinant, Human, aa1-291, His-SUMO-Tag (Kidney Mitochondrial Carrier Protein 1)
• Artikelnummer: USB-375317
• Hersteller Artikelnummer: 375317
• Alternativnummer: USB-375317-20,USB-375317-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Probable transporter. Source: Recombinant protein corresponding to aa1-291 from human SLC25A30, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.5kD Amino Acid Sequence: MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGM

Produkteigenschaften

• Molekulargewicht: 48.5
• UniProt: Q5SVS4
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.