SLURP1, Recombinant, Human, aa23-103, His-Tag (Secreted Ly-6/uPAR-related Protein 1)

Produktübersicht

• Artikelname: SLURP1, Recombinant, Human, aa23-103, His-Tag (Secreted Ly-6/uPAR-related Protein 1)
• Artikelnummer: USB-375327
• Hersteller Artikelnummer: 375327
• Alternativnummer: USB-375327-20,USB-375327-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Source: Recombinant protein corresponding to aa23-103 from human SLURP1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD Amino Acid Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 12.9
• UniProt: P55000
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.