SPAG16, Recombinant, Human, aa1-183, GST-Tag (Sperm-associated Antigen 16 Protein)

Artikelnummer: USB-375378
Artikelname: SPAG16, Recombinant, Human, aa1-183, GST-Tag (Sperm-associated Antigen 16 Protein)
Artikelnummer: USB-375378
Hersteller Artikelnummer: 375378
Alternativnummer: USB-375378-20,USB-375378-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia. Source: Recombinant protein corresponding to aa1-183 from human SPAG16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.6kD Amino Acid Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.6
UniProt: Q8N0X2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.