SPEG, Recombinant, Human, aa1-113, GST-Tag (Striated Muscle Preferentially Expressed Protein Kinase)

Produktübersicht

• Artikelname: SPEG, Recombinant, Human, aa1-113, GST-Tag (Striated Muscle Preferentially Expressed Protein Kinase)
• Artikelnummer: USB-375384
• Hersteller Artikelnummer: 375384
• Alternativnummer: USB-375384-20,USB-375384-100,USB-375384-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells. Source: Recombinant protein corresponding to aa1-113 from human SPEG, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.7kD Amino Acid Sequence: MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 38.7
• UniProt: Q15772
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.