SSB, Recombinant, Bacillus anthracis, aa1-172, His-SUMO-Tag (Single-stranded DNA-binding Protein)

Artikelnummer: USB-375418
Artikelname: SSB, Recombinant, Bacillus anthracis, aa1-172, His-SUMO-Tag (Single-stranded DNA-binding Protein)
Artikelnummer: USB-375418
Hersteller Artikelnummer: 375418
Alternativnummer: USB-375418-20,USB-375418-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism. Full length recombinant protein corresponding to aa1-172 from bacillus anthracis SSB, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.7kD Amino Acid Sequence: MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.7
UniProt: Q81JI3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.