UCP1, Recombinant, Human, aa2-307, His-Tag (Mitochondrial Brown Fat Uncoupling Protein 1)

Produktübersicht

• Artikelname: UCP1, Recombinant, Human, aa2-307, His-Tag (Mitochondrial Brown Fat Uncoupling Protein 1)
• Artikelnummer: USB-375761
• Hersteller Artikelnummer: 375761
• Alternativnummer: USB-375761-20,USB-375761-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. Source: Recombinant protein corresponding to aa2-307 from human UCP1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~34.9kD Amino Acid Sequence: GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 34.9
• UniProt: P25874
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.