VEGFA, Recombinant, Rat, aa27-214, His-Tag (Vascular Endothelial Growth Factor A)

Produktübersicht

• Artikelname: VEGFA, Recombinant, Rat, aa27-214, His-Tag (Vascular Endothelial Growth Factor A)
• Artikelnummer: USB-375814
• Hersteller Artikelnummer: 375814
• Alternativnummer: USB-375814-20,USB-375814-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis. Source: Recombinant protein corresponding to aa27-214 from rat VEGFA, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD Amino Acid Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.1
• UniProt: P16612
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.