VP40, Recombinant, Zaire Ebolavirus, aa1-326, His-SUMO-Tag (Matrix Protein VP40)

Artikelnummer: USB-375841
Artikelname: VP40, Recombinant, Zaire Ebolavirus, aa1-326, His-SUMO-Tag (Matrix Protein VP40)
Artikelnummer: USB-375841
Hersteller Artikelnummer: 375841
Alternativnummer: USB-375841-20,USB-375841-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication. Source: Recombinant protein corresponding to aa1-326 from full length zaire ebolavirus VP40, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.2kD Amino Acid Sequence: MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.2
UniProt: Q77DJ6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.