VWA5B2, Recombinant, Human, aa781-862, His-SUMO-Tag (Von Willebrand Factor A Domain-containing Protein 5B2)

Produktübersicht

• Artikelname: VWA5B2, Recombinant, Human, aa781-862, His-SUMO-Tag (Von Willebrand Factor A Domain-containing Protein 5B2)
• Artikelnummer: USB-375854
• Hersteller Artikelnummer: 375854
• Alternativnummer: USB-375854-20,USB-375854-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa781-862 from human VWA5B2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.6kD Amino Acid Sequence: PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVI

Produkteigenschaften

• Molekulargewicht: 24.6
• UniProt: Q8N398
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a liquid in Tris, 50% glycerol.