CASP3 (Caspase-3, Caspase 3, Apoptosis-Related Cysteine Peptidase), Rabbit
Artikelnummer:
USB-477128
- Bilder (0)
| Artikelname: | CASP3 (Caspase-3, Caspase 3, Apoptosis-Related Cysteine Peptidase), Rabbit |
| Artikelnummer: | USB-477128 |
| Hersteller Artikelnummer: | 477128 |
| Alternativnummer: | USB-477128-100 |
| Hersteller: | US Biological |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Immunogen: | Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII of the N-terminal region of human CASP3. Species sequence homology: bovine, canine, guinea pig, equine, porcine, rabbit and rat |
| CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimers disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. Applications: Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
