Anti-OPG [AbAb01OPG], IgG1, Mouse, Monoclonal

Catalog Number: ABA-AB04113-1.1-BT
Article Name: Anti-OPG [AbAb01OPG], IgG1, Mouse, Monoclonal
Biozol Catalog Number: ABA-AB04113-1.1-BT
Supplier Catalog Number: Ab04113-1.1-BT
Alternative Catalog Number: ABA-AB04113-1.1-BT
Manufacturer: Absolute Antibody
Host: Mouse
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Alternative Names: Osteoprotegerin, OCIF, PDB5, TR1, TNFRSF11B, Tumor necrosis factor receptor superfamily member 11b, TNF receptor superfamily member 11b, Osteoclastogenesis inhibitory factor
The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).
Clonality: Monoclonal
Clone Designation: [AbAb01OPG]
Isotype: IgG1
UniProt: O00300
Buffer: PBS only.
Target: OPG