Anti-OPG [AbAb02OPG], Rabbit, Monoclonal

Product Overview

• Article Name: Anti-OPG [AbAb02OPG], Rabbit, Monoclonal
• Biozol Catalog Number: ABA-AB04114-23.0
• Supplier Catalog Number: Ab04114-23.0
• Alternative Catalog Number: ABA-AB04114-23.0
• Manufacturer: Absolute Antibody
• Host: Rabbit
• Category: Antikörper
• Application: ELISA
• Species Reactivity: Human
• Alternative Names: Osteoprotegerin, OCIF, PDB5, TR1, TNFRSF11B, Tumor necrosis factor receptor superfamily member 11b, TNF receptor superfamily member 11b, Osteoclastogenesis inhibitory factor

Product Description

The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).

Product Properties

• Clonality: Monoclonal
• Clone Designation: [AbAb02OPG]
• UniProt: O00300
• Buffer: PBS with 0.02% Proclin 300.
• Target: OPG