Caveolin-1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0059
Article Name: Caveolin-1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0059
Supplier Catalog Number: A0059
Alternative Catalog Number: ABB-A0059-100UL,ABB-A0059-20UL,ABB-A0059-500UL,ABB-A0059-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CGL3, PPH3, BSCL3, LCCNS, VIP21, MSTP085, Caveolin-1
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 857
UniProt: Q03135
Purity: Affinity purification
Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY
Target: CAV1
Antibody Type: Primary Antibody
Application Dilute: IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Insulin Receptor Signaling Pathway,Cardiovascular,Hypoxia,Lipids