PGP9.5/UCHL1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PGP9.5/UCHL1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0148
• Supplier Catalog Number: A0148
• Alternative Catalog Number: ABB-A0148-100UL,ABB-A0148-20UL,ABB-A0148-500UL,ABB-A0148-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NDGOA, PARK5, PGP95, SPG79, PGP9.5, SPG79A, UCHL-1, Uch-L1, HEL-117, PGP 9.5, HEL-S-53, PGP9.5/UCHL1

Product Description

The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 25kDa
• NCBI: 7345
• UniProt: P09936
• Purity: Affinity purification
• Sequence: HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
• Target: UCHL1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Neuron marker