IRF7 Rabbit pAb, Unconjugated

Product Overview

• Article Name: IRF7 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0159
• Supplier Catalog Number: A0159
• Alternative Catalog Number: ABB-A0159-100UL,ABB-A0159-20UL,ABB-A0159-1000UL,ABB-A0159-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IMD39, IRF-7, IRF7A, IRF7B, IRF7C, IRF7H, IRF-7H, IRF7

Product Description

This gene encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. It has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. The encoded protein plays an important role in the innate immune response against DNA and RNA viruses.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 54kDa
• NCBI: 3665
• UniProt: Q92985
• Purity: Affinity purification
• Sequence: KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
• Target: IRF7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Immunology Inflammation,Cytokines,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling