Anti-Dio3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10023-100
Article Name: Anti-Dio3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10023-100
Supplier Catalog Number: A10023-100
Alternative Catalog Number: ABC-A10023-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human DIO3 (NP_001353.4).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Dio3.
Clonality: Polyclonal
Molecular Weight: 34 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: HFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTU
Target: Dio3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000