Anti-AF4 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10032-100
Article Name: Anti-AF4 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10032-100
Supplier Catalog Number: A10032-100
Alternative Catalog Number: ABC-A10032-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1124-1218 of human AFF1 (NP_001160165.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to AF4.
Clonality: Polyclonal
Molecular Weight: 135 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: SQSSAGSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSSLVDLVHYTRQGFQQLQELTKTP
Target: AF4
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:100