Anti-Cyclin E2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10048-100
Article Name: Anti-Cyclin E2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10048-100
Supplier Catalog Number: A10048-100
Alternative Catalog Number: ABC-A10048-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 255-404 of human Cyclin E2 (NP_477097.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Cyclin E2.
Clonality: Polyclonal
Molecular Weight: 47 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: ALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Target: Cyclin E2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200