Anti-Cyclin E2 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A10048-100
Article Name: |
Anti-Cyclin E2 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A10048-100 |
Supplier Catalog Number: |
A10048-100 |
Alternative Catalog Number: |
ABC-A10048-100 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ICC, WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 255-404 of human Cyclin E2 (NP_477097.1). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to Cyclin E2. |
Clonality: |
Polyclonal |
Molecular Weight: |
47 kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
Form: |
Liquid |
Sequence: |
ALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH |
Target: |
Cyclin E2 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:2,000, ICC/IF: 1:50-1:200 |