Anti-AGR2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10053-100
Article Name: Anti-AGR2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10053-100
Supplier Catalog Number: A10053-100
Alternative Catalog Number: ABC-A10053-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-175 of human AGR2 (NP_006399.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to AGR2.
Clonality: Polyclonal
Molecular Weight: 20 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Target: AGR2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200